Roleplay Discord servers

🔎 Search
🏷️ Tags
🔞 Age Requirement
📊 Sorting
👥 Server Size
📅 Server Age

210 servers found

server profile pic
Rus' | Into The Frost
adventurefantasymedievalroleplay
Description

With a long winter preparing to encapsulate the Tsardom of Rus' and all living things within the Russkaya Zemlya, we invite you to join us in the new and improved Rus' Universe. Dobro pozhalovat' v Rus! Welcome to the Rus', my friend. The "Rus' | Into The Frost" is a server based on 15th-Century Medieval Russia with a fantasy twist. Imagine a world where legendary creatures found in traditional folklore coexisted alongside ManKind. It is in our universe that adventurers from all corners of the globe travel to the Land of the Rus' to test their mettle against the ferocious beasts that dominate the cold lands. Limited by only your own brilliant creativity, you are allowed to start off as a majestic and nimble Kitsune from the Far East—using magic to turn your foes to dust. You can even try to slay beasts as an Elven Archer from the Germanic Region who can strike down their prey from miles away, a werewolf, vampire, orc, and so much more. Don't be afraid to strive for whatever your artistic mind desires. This is a community that accepts all passionate to write, role-play, and help build an immersive universe influenced by its members and everything we do as a community. Upon joining, we ask that you take the time to read the instructions provided in our welcome channel. We are a very well-written and fleshed-out server. We hope that you'll be joining us very soon on our courageous adventures, friend.

Today's activity
187💬
14🟢
8👥
0📞
Server overview
40👥Total members
3📅years old
18+Age requirement
server profile pic
|| JJK || The Jujutsu Experience
jjkjjk roleplayjjk rpjujutsu kaisenjujutsu kaisen roleplayjujutsu kaisen rproleplay
user profile pic
gumeybear2122-09-2024 13:04

a

Description

The Jujutsu Experience! It's a roleplaying/hangout JJK server!! Your oc's make the future! It's simple and an up n' coming server. - Cannon Techniques to be claimed by YOUR ocs ;o - Friendly staff (I think I'm friendly anyways) - Easy to understand templates - Sukuna's vessel up for grabs >:)) So why don't you come on down and join! Even if you just want to hangout and chat, that's what we're here for, but if you want to rp, come make an oc that'll shape the lore of the server!

Today's activity
17💬
75🟢
5👥
0📞
Server overview
288👥Total members
1📅years old
13+Age requirement
Description

𝐖𝐄𝐋𝐂𝐎𝐌𝐄 𝐓𝐎 𝐓𝐇𝐄 𝐂𝐔𝐑𝐒𝐄𝐃 𝐑𝐄𝐀𝐋𝐌

𝑵𝒆𝒘 𝑺𝒆𝒓𝒗𝒆𝒓 (𝑫𝒆𝒗𝒆𝒍𝒐𝒑𝒊𝒏𝒈)

𝐶𝑜𝑚𝑚𝑢𝑛𝑖𝑡𝑦
Our server is not only based off of Jujutsu Kaisen or Anime only. We have a comfy and wonderful area for everyone alike. Welcoming all gamers and anyone who would like a community to surround them!

𝑅𝑜𝑙𝑒𝑝𝑙𝑎𝑦
Our roleplays are not strictly based off of Jujutsu Kaisen. It does not have to follow canon 100%, but we do have canon channels for our storylines. You are welcome to roleplay any outside AUs or crazy situations with Crack Roleplay channels! Make sure Roleplay is fair and everyone can play without fights between ideals. (This Includes if someone is uncomfortable in a CRP or Crack Rp)

𝐺𝑎𝑚𝑖𝑛𝑔 𝑎𝑛𝑑 𝑆𝑡𝑟𝑒𝑎𝑚𝑠
We welcome Discord Streamers and Gamers alike! If your an anime junkie, we also have channels for that too! Stream within our designated channels, keep game talk in the gaming channel, and have some fun!!

𝑃𝑟𝑜𝑓𝑎𝑛𝑖𝑡𝑦, 𝑁𝑆𝐹𝑊, 𝑎𝑛𝑑 𝑆𝑙𝑢𝑟𝑠
Profanity is Allowed in our server, aswell as NSFW. SLURS ARE NOT ALLOWED AND WILL RESULT IN A BAN. we allow the use of profanity as it is a common habit of human nature, but slurs are stict prohibited and against our server's peace. NSFW is allowed, but it MUST stay in its DESIGNATED CHANNEL. If you are caught posting NSFW images outside of the NSFW channel, you will be warned. ERP is allowed, but with the use of a thread listed as NSFW Roleplay (characters names) or ERP( Characters names).

1st Offense = Timeout
2nd Offense = Kick
3rd and Final Offense = BANNED

𝐶𝑎𝑛𝑜𝑛 𝑎𝑛𝑑 𝑂𝐶𝑠 𝐴𝑙𝑙𝑜𝑤𝑒𝑑
We offer both your choice of making and using your own OC to fewl comfortable within Roleplay. We also have a wide variety of canons to choose from!

Today's activity
17💬
18🟢
3👥
0📞
Server overview
45👥Total members
2📅years old
16+Age requirement
server profile pic
The Writer's Library {{21+}}
friendlysocialroleplayrpcommunitywritingroleplayerroleplay partnerwritersactive
Description

Welcome to the Writers Library. All writing levels are welcome! We are a 21+ Role Play server. We do request your work be human written. Here you can find yourself lost in the pages of your own creations and meet other writers to join you.

Today's activity
4.5k💬
72🟢
75👥
9📞
Server overview
307👥Total members
6📅months old
21+Age requirement
server profile pic
city in the sky · fluffy tag
socialcommunityactivechillroleplaygaminganimegameshangoutartfunfriendlyroleplay
user profile pic
luna005124-01-2025 21:27

Best server ever

user profile pic
luna005124-01-2025 21:27

Rizz

user profile pic
luna005124-01-2025 21:27

10/10

user profile pic
luna005124-01-2025 21:27

Perfect

Description

📢FRESH NEW 2025 COMMUNITY 🔥🔥 TONS OF PEOPLE TO CHAT WITH 💜🎁MASSIVE GIVEAWAYS ✅✅ COMMUNITY EVENTS 🍉 AND SO MUCH MORE 💯💯

Today's activity
2.6k💬
366🟢
75👥
1📞
Server overview
2.9k👥Total members
1📅years old
13+Age requirement
server profile pic
The Starry Justice Show! (Arc 2)
canon characterscanons welcomehorrormagicmagical girlroleplayrpanimesocial
Description

"Good morning, dear viewer— And welcome to The Starry Justice Show... A live-action show that focuses on the lives of very special Magical Girls, and our titular Starry Justice. Both the mundane and the extraordinary, only the most interesting segments will be broadcasted for your viewing pleasure. Please enjoy~" || Without warning, people from all across the planet are contacted by strange beings, explaining to them that they have been gifted with the ability to turn into a Magical Girl. Why? Evil creatures have started to appear from beyond the stars, threatening to destroy the world. Not only do these Magical Girls have to protect the planet, they have to do so while being almost constantly broadcasted to every television or radio, in a squeaky-clean, all age friendly TV program. Failure to commit to their new roles will result in them transforming into Witches, themselves...

Today's activity
1.8k💬
65🟢
30👥
0📞
Server overview
235👥Total members
2📅years old
13+Age requirement
server profile pic
Puella Magi: Maeror Magica
madokamadokamagicamagical girlpmmmroleplay
Description

Welcome to Kazamuki City! In the City of Four Winds, will you be a normal civilian, a wielder of magic, or even a witch?

Puella Magi: Maeror Magica is a roleplaying server based on the Puella Magi franchise. Explore Kazamuki City, fight against other characters, discover horrifying truths, or fall to despair- you decide where the story goes!

This server includes:
- An active moderation team
- Art and writing channels
- A wide range of characters (non-female magi are allowed)
- Multiple character types (magi, witch, civilian)
- Spectator roles for those who don't want to (or will later) join the game.

Today's activity
10💬
29🟢
4👥
0📞
Server overview
154👥Total members
4📅years old
15+Age requirement
server profile pic
Monarch's Domain
communitychillroleplayanimegameshangoutfriendsfunfriendlyartsolo levelinggaming
Description

A simple Solo Leveling community that operates on one brain cell but is close like a family!
Gaming🎮 : We all play games here and a variety as well some examples such as (Fortnite🧱, Minecraft⛏️, Roblox🤠, Valorant🔫) and much more!

Anime🇯🇵 & Movies🍿: We watch all kinds of Anime and movies and host watch parties for them too! So feel free to pop in and watch!😁

Giveaways🎉: We host frequent giveaways like Nitro💨, PSN, Xbox and Steam gift cards👀 and many more!

Leveling system⬆️: Level up in the server by messaging and voice chatting for more xp that gives you higher roles in the server and benefits!!

And plenty more where that came from🤭! Feel free to join now!

Today's activity
1.3k💬
54🟢
40👥
19📞
Server overview
1.2k👥Total members
3📅years old
13+Age requirement
server profile pic
The Russian Language
languagelearninglearnrussianrussiasocialcommunitychillroleplaygaminggamesanimehangoutfriendsfunfriendlysfwchatmusicactiveminecraftmemesmovieseventsfantasy
Description

A friendly and open community, where we study Russian together. If you want to learn Russian, join our Russian classes and language exchange sessions.

Today's activity
1.0k💬
832🟢
66👥
10📞
Server overview
6.0k👥Total members
5📅years old
13+Age requirement
server profile pic
It's Your Power!
roleplayrpmhamy hero academiamha-rproleplayingmy hero academia-roleplay)my hero academia-rppartnership
Description

🌟 IT’S YOUR POWER! — MY HERO ACADEMIA RP 🌟

🦸‍♂️ Do you have a hero OC?
🦹 A villain with a cause?
👤 Or a civilian just trying to survive in a superpowered world?

It’s Your Power! is a My Hero Academia–based roleplay server set in a post-war, hybrid timeline, where hero society is rebuilding—and redefining itself.

In this world, most humans possess Quirks, superhuman abilities that shape daily life, careers, and conflict. Hero schools still stand, villains still lurk, and the line between right and wrong has never been thinner.

What sets us apart?

✨ Play who you want.
You’re not limited to hero students. Play:
Hero students, Pro Heroes, Villains, Vigilantes, Civilians, Support and business roles
…and more.

🏫 Multiple Hero Schools

U.A. High School

Shiketsu High School

Deika City University (DCU) — a bold, experience-first hero institution

📖 Story-Driven World
The world reflects the consequences of canon events, while leaving room for player-driven stories, growth, and server-wide arcs.

🌈 Inclusive & Community-Focused
Whether you’re here for intense plots, character development, or casual RP, there’s a place for you.

🔹 What We Offer:

• Friendly and welcoming community
• Clear rules and active staff
• Self-assignable roles
• Open RP channels (no forum locking)
• RP events and story arcs
• LGBTQ+ friendly environment
• Unlimited original characters
• Canon characters available to claim
• Partnerships welcome

Step into a world where power doesn’t define destiny.

It’s not about the Quirk you’re born with.
It’s about what you choose to do with it.

💥 It’s Your Power! 💥

Today's activity
1.0k💬
53🟢
32👥
0📞
Server overview
130👥Total members
3📅months old
15+Age requirement
server profile pic
Echoes of Crystal
communityd&ddnddungeons and dragonsfantasyliterateroleplayttrpgwest marchwriting
Description

Get in on the ground floor of a new west march like no other. One shots, campaigns, traditional DnD, experimental games -- if a DM wants to run it, we want to play it! VC and PBP games are available, with an innovative setting that allows you to bring back your favorite characters from dead servers or home campaigns or create new ones, and a special mechanic that makes it so you never level out of early content. Strong DM freedoms to run your own table, and warm and welcoming community. Can you hear the crystals calling?

Today's activity
951💬
36🟢
19👥
0📞
Server overview
137👥Total members
2📅years old
14+Age requirement
server profile pic
🔥𝐂𝐢𝐭𝐲 𝐨𝐟 𝐁𝐫𝐚𝐬𝐬🔥
dungeons and dragonsd&dttrpghobbiesdndtabletoproleplay
Description

The City of Brass is a place for people to share and discuss their hobbies, favorite media, and worldbuilding projects; whether it be for a tabletop game like Dungeons and Dragons, or just for the fun of it! We also like to make and give/receive feedback on Hombrew content for D&D!

Today's activity
872💬
30🟢
9👥
0📞
Server overview
81👥Total members
4📅years old
18+Age requirement
server profile pic
Divinity's Rapture
communityroleplayroleplayingchillsocialanimelgbtq+fireemblemfe3h18+anime rp
Description

(SFW RP, but hidden ooc nsfw channel)

(Past and "modern" versions of characters are, essentially, separate people, and exist at the same time.)

The year is 1885, nearly 700 years after the War of Unification for Fódlan. Peace and prosperity reigned across the land as students far and wide made their way to the esteemed officers academy. A professor awaits for a new opportunity to teach as three important heirs make their way to Garreg Mach alongside their comrades. Little did any of them know however the peace they knew would come crashing down. Those from the past arrived both friend and foe. While the newly lost Fell Star seeks to restore balance and preserve this world the King of Liberation and his allies move to conquer and destroy. For the past was never meant to encounter the future and the dead should have been left to rest. Memories blur as the inhabitants of Garreg Mach attempt to understand who they are and what this all entails.

(Welcome to Divinity’s Rapture! An FE3H time travel au featuring the messy attempts at finding a perfect ending and the consequences that follow. Follow the story as the past is flung into an alternate far future all while reality desperately attempts to piece itself together. )

Today's activity
844💬
28🟢
15👥
0📞
Server overview
41👥Total members
11📅months old
18+Age requirement
server profile pic
DECEIT [RP]
communityroleplayrp
Description

˗ˏˋ ✞ ˎˊ˗ 𝐃𝐄𝐂𝐄𝐈𝐓 ˗ˏˋ ✞ ˎˊ˗ “I will not tell you the visceral details as you already know them, you all do. It's happening to every-body.”
═══════════════
On the eve of the outbreak, Southwood, Alabama's population sat at 8,000. Now? hundreds, a bustling coastal city transformed into nothing more than a shell of it's former glory. It wasn't always this way, yet an inconceivable turn of events left thousands wondering if hope was well and truly lost. You weren't lucky enough to be picked up by the military convoys that left town at the behest of the United States Government, no, you were left behind, discarded, and no matter how unhappy you were about that fact, nothing could change how you were now among Fairhope's last remaining inhabitants. There was no telling just what could happen, the cataclysm of the world as we know it was sure to bring about some major changes. Were you going to embrace it, or desperately cling onto whatever hope humanity had left..?
═══════════════
“No-one you know is a good person.”
═══════════════
What Deceit Offers... {✞}

HORROR + APOCALYPTIC THEMES — Built by a team of previous apocalypse-RPers, Deceit offers a range of apocalyptic themes within it's plotlines, all based in the fictional coastal town of Southwood, Alabama . We don't merely focus on the dark, gritty aspects of the apocalypse, but also the wider picture. We aim to make our world as immersive as possible so that everyone can get the most enjoyment out of roleplaying here.

{✞} CREATIVE SPACE FOR ALL SKILL-LEVELS — With the rise in AI over recent years, we've noticed a severe lack in creative spaces. Deceit offers a creative outlet for writers of all skill-levels, whether you're literate writer who wants to improve their work, or a multi-paragraph writer who wants to tell an immersive story, there's a place for you here. AI is banned entirely.

{✞} INTERACTIVE LORE — We've implemented not only a D20 system, but also certain guidelines for events that mean your choices matter. There are real stakes behind every choice your character makes, meaning every single session carries a unique sort of tension. {✞} MEMBER FEEDBACK — Ultimately, we are not immune to taking criticism. If there are certain aspects of the server that you think could be improved upon, then tell us so we can ensure a positive experience for everyone.
═══════════════

Today's activity
798💬
26🟢
11👥
5📞
Server overview
45👥Total members
2📅years old
13+Age requirement
Description

A pretty chill Kirby Roleplay server. Just follow the rules and you’ll have fun. We’re currently a small server and we hope to see you join

Today's activity
20💬
31🟢
3👥
0📞
Server overview
76👥Total members
11📅months old
13+Age requirement
server profile pic
StarWars: RP
starwarsroleplaystarwars rpstarwars roleplaygroup rp
Description

ך Loreך The year is 56 ABY. After the countless wars and battles of the Old Republic, Galactic Empire, New Republic, and First Order, all governments splintered into small factions that fought for power and eventually drained all their resources. In the here and now, the galaxy survives, with powerful factions fighting for territory. Bounty hunters and smugglers roam the skies more freely than ever. Those seeking out the Sith and the Jedi often hit a dead end, as they are only mentioned in drunken tales told in bars or whispers from old timers in the night. In decades past, the Sith sought power through the dark side of the Force, and the Jedi used the light side of the Force to bring peace to the galaxy. But now all the Sith and Jedi have been wiped out from a galaxy that long ago moved on without them. … Or have they? It would seem the Sith and the Jedi faded into legend and faint memory. But 56 years later, the core territories governments continue to govern the galaxy and protect the core and inner core galaxies. The mid and Outer-rim galaxies must fend for themselves, some planets having to protect and govern themselves. It’s an open world out there, where good, honest citizens don’t stand much of a chance, and criminal factions couldn’t be happier, with all these planets and credits for the taking. ךWhat you’ll see in this server ך Economics Scum and Villiany Questing GM Events Active engaging community Custom Ships, Factions and Equipment aswell as Legends and Canon material. Regular Updates Fair and Transparent Moderation.

Today's activity
713💬
74🟢
25👥
0📞
Server overview
318👥Total members
3📅years old
16+Age requirement
server profile pic
Fluid Client
communitysocialactivechillroleplaygaminghangoutgamescreativefriendsfunfriendlyartchatmusicvcsfwrobloxminecraft
Description

Ready to take your Minecraft adventures to the next level? Fluid Client, the unrivaled Minecraft client for 1.8.9, is your ticket to endless possibilities! 🌍 Unleash your imagination, conquer challenges, and build your way to victory! Download now at https://fluidclient.ovh/download.

Today's activity
18💬
419🟢
12👥
0📞
Server overview
10.1k👥Total members
2📅years old
13+Age requirement
server profile pic
Tales of Ideals
roleplaysuperherosuperheroes
user profile pic
the_sigg02-09-2024 13:23

Testing!

user profile pic
the_sigg02-09-2024 13:24

Hey there, get in!

Description

***For as long as humans have dreamed, we have dreamed of heroes.*** ***What if these dreams could come true? Could the world handle such power?*** ***These are...*** # _ _ _ _ 『 𝕋𝕒𝕝𝕖𝕤 𝕠𝕗 𝕀𝕕𝕖𝕒𝕝𝕤 』 _ _ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ ╚══《✧》══╝ Set in an alternate history version of our world, __**Tales of Ideals**__ tells the story of a world where superheroes have gone all but extinct. Following the destruction of much of civilization, society has lost faith in its protectors. In the United States, those that remain are under the watch of the **Superhuman Public Response** team. Now, in the year 2024, the balance of the world is in the hands of a new age of superheroes. Stagnant for decades, it is finally time for them to rise up again... but will they succeed? Will crime and villainy prevail at last? Or will this age die out before it gets going, and force the world to recover without supers? ### *The future is up to you!* _ _ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ╔══《✧》══╗ ## 𝓕𝓔𝓐𝓣𝓤𝓡𝓘𝓝𝓖: 💥 A world with decades of alternate history to discover! 🌎 Over **60** channels to roleplay in! 👊 The ability to create your own superheroes (or villains!) 🔥 A narrative focused approach, with an evolving world! ⚡ A class- & archetype-based system of character growth!

Today's activity
594💬
17🟢
12👥
0📞
Server overview
45👥Total members
1📅years old
18+Age requirement
Description

𝐒𝐄𝐕𝐄𝐍.. 𝐒𝐈𝐗... 𝐄𝐋𝐄𝐕𝐄𝐍... 𝐅𝐈𝐕𝐄... 𝐍𝐈𝐍𝐄 𝐀𝐍' 𝐓𝐖𝐄𝐍𝐓𝐘 𝐌𝐈𝐋𝐄 𝐓𝐎-𝐃𝐀𝐘... 𝐅𝐎𝐔𝐑... 𝐄𝐋𝐄𝐕𝐄𝐍.. 𝐒𝐄𝐕𝐄𝐍𝐓𝐄𝐄𝐍.. 𝐓𝐇𝐈𝐑𝐓𝐘-𝐓𝐖𝐎 𝐓𝐇𝐄 𝐃𝐀𝐘 𝐁𝐄𝐅𝐎𝐑𝐄..

⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆
est. 7th November 2023. The most long lasting, active vibey aot rp server you'll ever find. **SERVER TAG + EXCLUSIVE ROLES!!** ( and 24/7 poketwo)

Interested in joining a chill out aot rp server on disc thats also active, with amazing and hilarious (and actual NON toxic) members? This server supports all styles of RPing. Here's why you should join:
╰┈➤There are SO many available canon characters to choose from, (and by choosing a canon, you're also guaranteed a unique role, [yes- even the "minor side characters"] no service required!) and we LOVE OCs!! There are many activities that take place including royal balls/galas, battles, path sequences and so much more.. and even an actor au! ╰┈➤The server allows you to focus on your character as well as their interactions with others. NO ONE is ever left out in the plot.
╰┈➤Choose where your character comes from (if an OC) I.E Marleyan or Eldian. There are loads and loads of different channels, (including Marley, beyond the walls, and more!) This server also doesn't have an over-the-top combat system or rules, you can go crazy! (just not OP.)
╰┈➤The plot has a perfect balance of comedy, combat, romance, serious RP and many tear jerking moments.
╰┈➤ This server is perfect for any RPer who is just starting out, getting back into the fandom, or just wants a chance to show off some writing. But wait, there's more!
╰┈➤ We don't just do RP here. We have regular silly VC's, music nights, game streams, UNO, and many more! With that said, thank you so much and I know we'll all be able to give eachother a memorable RP experience!
⋆⁺₊⋆ ━━━━⊱༒︎ • ༒︎⊰━━━━ ⋆⁺₊⋆

𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒... 𝐁𝐎𝐎𝐓𝐒.. 𝐁𝐎𝐎𝐓𝐒.. 𝐌𝐎𝐕𝐈𝐍' 𝐔𝐏 𝐀𝐍' 𝐃𝐎𝐖𝐍 𝐀𝐆𝐀𝐈𝐍.. 𝐓𝐇𝐄𝐑𝐄'𝐒 𝐍𝐎 𝐃𝐈𝐒𝐂𝐇𝐀𝐑𝐆𝐄 𝐈𝐍 𝐓𝐇𝐄 𝗪𝐀𝐑.

Today's activity
5.1k💬
110🟢
55👥
0📞
Server overview
491👥Total members
2📅years old
13+Age requirement
server profile pic
𝗗𝟰
communitysocialchillgamingroleplaygameshangoutanimefriendsfunfriendlyartchatmusicactiverobloxvcsfwminecraftlgbtq+memesmangarpeventspoliticsvaloranthorrorenglishnon-toxicprogramminganime rpaireading13+egirlslgbtqcatslgbtq friendlyteenactive-communitysportstechnologyfootballvoice chatnontoxicgamersbooksmusic producersegirlbookclubcutegtaadultsvoice-chatemojiartsmusicianteensgoofyweedactive-voicechatsmoking420gamerapexteen-friendlyhouse of the dragonanime rpgvcsemojisfun factsgame nightsvaporwavetechnicallgbtq+ friendlygame-devraidsno toxicitygta vdevelopershang outpersonal developmentmusic botsemoclassical musiceboystomb-raidersoccerstorytechlgbt friendlysocial community vc fun friendlyraidingskateboardinggamer-girlsweebnukevapingeboyd4gamer-girlskatingscooteractive voice chatraiderssk8stonervaporprogrammersskatergamergirlpartnershippartnershipspartnerpvppcskateskateboardskawritingmoviemovie nightmoviesmovie nightsfilm
Description

𝗗𝟰 𝗶𝘀 𝘁𝗮𝗶𝗹𝗼𝗿𝗲𝗱 𝘁𝗼 𝗮𝗹𝗹 𝗽𝗲𝗼𝗽𝗹𝗲 𝘄𝗵𝗼 𝗷𝗼𝗶𝗻.
● sғᴡ → ᴀʀᴛ
● ᴛᴇᴄʜ → ᴀɴɪᴍᴇ
● ᴍᴜsɪᴄ → ᴍᴇᴍᴇs
● ᴇᴠᴇɴᴛs → sᴏᴄɪᴀʟ
● ᴀᴄᴛɪᴠᴇ → ᴠᴀᴘᴇʀs
● ᴇ-ʙᴏʏs → ʜɪᴘᴘɪᴇs
● ɢᴀᴍɪɴɢ → ᴇ-ɢɪʀʟs
● sᴋᴀᴛᴇʀs → sᴛᴏɴᴇʀs
● ᴇǫᴜᴀʟɪᴛʏ → ᴀᴛʜʟᴇᴛᴇs
● ᴍᴜsɪᴄɪᴀɴs → sᴛʀᴇᴀᴍɪɴɢ
● ʀᴀᴘ-ʙᴀᴛᴛʟᴇs→ ɴᴏɴ-sᴛᴏɴᴇʀs
● ᴘʀᴏɢʀᴀᴍᴍɪɴɢ → ᴄʏʙᴇʀ-sᴇᴄᴜʀɪᴛʏ
● ᴄᴀᴛᴄʜɪɴɢ-ᴘᴇᴅᴏs → ғʀᴇᴇ-ᴇxᴘʀᴇssɪᴏɴ
● ᴀɴᴛɪ-ᴄᴏʀʀᴜᴘᴛɪᴏɴ → ᴍᴜsɪᴄ-ᴘʀᴏᴅᴜᴄᴇʀs
● ᴄᴏɴᴛᴇɴᴛ -ᴄʀᴇᴀᴛᴏʀs → ᴘᴏᴇᴛʀʏ ᴀɴ ǫᴜᴏᴛᴇs
𝗧𝗵𝗲 𝗽𝗲𝗿𝗳𝗲𝗰𝘁 𝗽𝗹𝗮𝗰𝗲 𝗳𝗼𝗿 𝗺𝗲𝗲𝘁𝗶𝗻𝗴 𝗻𝗲𝘄 𝗽𝗲𝗼𝗽𝗹𝗲 𝗲𝘃𝗲𝗿𝘆𝗱𝗮𝘆.

NON-TOXIC

Today's activity
592💬
162🟢
38👥
4📞
Server overview
714👥Total members
10📅months old
13+Age requirement
server profile pic
/saucee | ask2dm • egirls • dating • social • active
socialcommunitychillroleplaygamesanimefriendsactivemoviesdatingegirledatingfreakyactive-voicechat
Description

𝗦𝗮𝘂𝗰𝗲 𝗶𝘀 𝗮 𝗺𝘂𝗹𝘁𝗶-𝗰𝗼𝗺𝗺𝘂𝗻𝗶𝘁𝘆 GROWING 𝗽𝘂𝗯𝗹𝗶𝗰 𝘀𝗲𝗿𝘃𝗲𝗿

𝖶𝖾 𝖺𝗋𝖾 𝖺 𝗁𝖾𝖺𝗅𝗍𝗁𝗒, 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 , 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 , 𝖽𝖺𝗍𝗂𝗇𝗀 , 𝗌𝗈𝖼𝗂𝖺𝗅𝗂𝗌𝗂𝗇𝗀 , 𝗀𝖺𝗆𝖾𝗌 , 𝗆𝗈𝗏𝗂𝖾𝗌 , 𝗂𝗇𝗍𝖾𝗋𝗇𝖺𝗍𝗂𝗈𝗇𝖺𝗅 , 𝖤-𝗍𝗁𝗂𝗇𝗀𝗌 𝖾𝗍𝖼 𝗍𝗒𝗉𝖾 𝗈𝖿 𝖲𝖤𝖱𝖵𝖤𝖱

𝖳𝗁𝖾 𝗆𝖾𝗆𝖻𝖾𝗋𝗌 (S𝖺𝗎𝖼𝖾𝗋𝗌) 𝗁𝖾𝗋𝖾 𝖼𝖺𝗇 𝖽𝗈 𝖺𝗇𝗒𝗍𝗁𝗂𝗇𝗀 𝖺𝗇𝖽 𝖾𝗏𝖾𝗋𝗒𝗍𝗁𝗂𝗇𝗀 𝗍𝗁𝖾𝗒 𝗐𝖺𝗇𝗍 𝗐𝗁𝗂𝖼𝗁 𝖿𝗈𝗅𝗅𝗈𝗐𝗌 𝗍𝗁𝖾 𝗋𝗎𝗅𝖾𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 RULES 。
𝖺𝗇𝖽 𝗂𝗍𝗌 𝗇𝗈𝗍 𝗌𝗈𝗆𝖾 𝗋𝖾𝖺𝗅𝗅𝗒 𝗌𝗍𝗋𝗂𝖼𝗍 𝗈𝗋 𝗁𝖺𝗋𝗌𝗁 𝗋𝗎𝗅𝖾𝗌 𝗃𝗎𝗌𝗍 𝖻𝖺𝗌𝗂𝖼 𝖼𝗂𝗏𝗂𝖼 𝗌𝖾𝗇𝗌𝖾.

𝖸𝗈𝗎 𝖼𝖺𝗇 𝗆𝖺𝗄𝖾 𝖿𝗋𝗂𝖾𝗇𝖽𝗌 𝖿𝗋𝗈𝗆 𝖽𝗂𝖿𝖿𝖾𝗋𝖾𝗇𝗍 𝗉𝖺𝗋𝗍𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗐𝗈𝗋𝗅𝖽 𝖺𝗇𝖽 𝗁𝖺𝗇𝗀𝗈𝗎𝗍 𝗐𝗂𝗍𝗁 𝗍𝗁𝖾𝗆, 𝗒𝗈𝗎 𝖼𝖺𝗇 𝖽𝖺𝗍𝖾 𝖺𝗇𝖽 𝖼𝗁𝗂𝗅𝗅 𝗁𝖾𝗋𝖾, 𝗉𝗈𝗌𝗍 𝗒𝗈𝗎𝗋𝗌𝖾𝗅𝖿 𝖺𝗇𝖽 𝖾𝗑𝗉𝗋𝖾𝗌𝗌 , 𝗌𝗁𝖺𝗋𝖾 𝗒𝗈𝗎𝗋 𝖼𝗋𝖾𝖺𝗍𝗂𝗏𝗂𝗍𝗒 , 𝗉𝗅𝖺𝗒 𝗐𝗂𝗍𝗁 𝖿𝗎𝗇 𝖻𝗈𝗍𝗌 𝗅𝗂𝗄𝖾 𝖮𝗐𝖮,𝗉𝗈𝗄𝖾𝗍𝗐𝗈 𝖺𝗇𝖽 𝗆𝖺𝗇𝗒 𝗆𝗈𝗋𝖾 , 𝖨𝗇𝗍𝖾𝗋𝖺𝖼𝗍 𝗐𝗂𝗍𝗁 𝗈𝗍𝗁𝖾𝗋 𝗍𝗁𝗂𝗇𝗀𝗌 𝗈𝖿 𝗍𝗁𝖾 𝗌𝖾𝗋𝗏𝖾𝗋 𝗅𝗂𝗄𝖾 𝗀𝖺𝗆𝗂𝗇𝗀, 𝗆𝗈𝗏𝗂𝖾𝗌, 𝗇𝗌𝖿𝗐 𝖾𝗍𝖼

𝖶𝖾'𝗋𝖾 𝖺𝗅𝗅 𝖺𝖻𝗈𝗎𝗍 𝖿𝗎𝗇, 𝖼𝗁𝖺𝗈𝗌, 𝖺𝗇𝖽 𝖼𝗈𝗆𝗆𝗎𝗇𝗂𝗍𝗒 — 𝗌𝗈 𝖽𝗂𝗏𝖾 𝗂𝗇, 𝗏𝗂𝖻𝖾 𝗈𝗎𝗍, 𝖺𝗇𝖽 𝗆𝖺𝗄𝖾 𝗌𝗈𝗆𝖾 𝗆𝖾𝗆𝗈𝗋𝗂𝖾𝗌. 𝖤𝗇𝗃𝗈𝗒 𝗒𝗈𝗎𝗋 𝗌𝗍𝖺𝗒 𝗂𝗇 S𝖺𝗎𝖼𝖾.

Today's activity
1.3k💬
165🟢
55👥
3📞
Server overview
2.2k👥Total members
1📅years old
18+Age requirement
server profile pic
Avalon Community | Dedicated Servers & Real Players
gamesgamingsocialminecraftroleplayhangout
Description

🌟 AvalonCS.net – Gaming Community 🎮 | ⛏️ Minecraft & more | 🔥 Events, levels, fun | 👥 Active team & great atmosphere!

Today's activity
36💬
131🟢
7👥
0📞
Server overview
1.0k👥Total members
8📅years old
13+Age requirement
server profile pic
★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★
roleplaysocialcommunitychillanimehangoutcreativemangaliterateocbleachbleach rpbleach roleplayanime rpanime roleplaymanga rp
user profile pic
coolin.real15-11-2024 18:14

hi guys!

Description

[**``黒— ★彡[Bleach: ☾ -ˏˋ⋆ 𝙸𝚗𝚏𝚒𝚗𝚒𝚝𝚎 𝙼𝚞𝚐𝚎𝚝𝚜𝚞 ⋆ˊˎ- 黒]彡★``**] ***Join our server for an interesting run, an adventure throughout multiple different worlds and realms, a deeper perspective on several different races and untold stories in this entirely new world. You may fight strong opponents, take on new heights, push yourself beyond your limits and even face off against those above! With or without a purpose, be a an active participant in the lore of our server that revolves entirely on you all. Destroy the strongest hollows or even reapers, quincies, fullbringers, humans (hell anything you name it) this era has ever known or just simply do your own thing; Awaken a bankai, shoot arrows, become an espada or develop a mask! The opportunities are practically endless in this Mugetsu world! With several systems to guide your very actions and several people willing to rp with you where could things go wrong? immerse yourself in our very own Bleach universe, and interact with fellow fans. With engaging roleplay, thrilling storylines, and a welcoming community, this server is the ultimate destination for fans of all ages. Don't miss out on the chance to explore the vast world of Bleach and create unforgettable memories with like-minded enthusiasts. Join now and let’s start up this journey today, Karakura town is awaiting you!*** **Our own unique take on Bleach, you took the time to read this far so we KNOW you’re interested!** **``We offer: A forum based oc submission system where we can easily interact with you and point out certain details Several different templates for multiple different things such as weaponry, zanpakuto, and the different races showcased in the anime/manga! An active staff team The chance to influence the story or have your own arcs Be part of the main cast! Everyone is really, I mean it! A multitude of different systems for important techniques and skills such as the transformations (such as bankai, shikai, training, resurrecion and mastery) A lot of channels that give background information on what you can do with the bleach power systems so even if you haven’t actually seen the series or read the manga you could read up for a basic understanding! The chance to utilise cool transformations, zanpakuto's, kido spells, or even create your own Influence a moving plot a money system a moving story and a chance to give your own two cents``** ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Links: https://discord.gg/uKK8Q3nggG [let's go, your journey starts now!](https://tenor.com/bQ7nQ.gif) Pings: ||@everyone @here||

Today's activity
9💬
117🟢
5👥
0📞
Server overview
498👥Total members
1📅years old
13+Age requirement
Description

ꕤ˖⸝⸝₊˚ Heiwa: 𝐆𝐨𝐥𝐝𝐞𝐧 𝐅𝐚𝐭𝐞 — a Medieval Fantasy Roleplay Server Long ago, the Epoch Shift shattered history; revealing a hidden orange-glowing moon, Nimiel, and changing the world as we know it. Civilizations now rise from the ruins, rediscovering old gods, lost kingdoms, and mysterious crystals embedded deep within the land. Ecosystems evolving far faster than we can keep up with, people redefining themselves and their lives. In this world, magic is a muscle, not an infinite force. Each spell strains the body. Power comes from training, endurance, and discipline. Your story begins here - when anything and everything you do can change the course of the story, how will you choose to live? 𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃𝄃𝄃𝄂𝄂𝄀𝄁𝄃𝄂𝄂𝄃 Heiwa is currently in a TRIAL PHASE. From now until NEW YEARS, the server is open for character-making and roleplaying, but no important lore events will occur. If you want to get in to make a mark before we truly kick off, now is the time! Deep, original lore (two moons, a shattered epoch, divine politics, unique magic system) Friendly, active community OC-focused, literate & semi-literate roleplay Medieval fantasy aesthetic Multiple regions, factions, and cultural paths Helpful staff, open channels for new players Event-driven storytelling + player-driven plots Safe, welcoming environment for all Ready to step into the new era? Join the world shaped by Mōna and awakened by Nimiel. Your story awaits.

Today's activity
25💬
43🟢
5👥
0📞
Server overview
103👥Total members
4📅months old
13+Age requirement
Description

"You'll face death, and it won't be pretty.
Enough death to leave your broken, time and time again...."

Congratulations! The application you submitted to become a part of Project Epsilon has been accepted! Welcome aboard!

Hello and a warm welcome to Halo: Project Epsilon! This is a server where you take the role as an agent of Epsilon. You will embark on a whole variety of missions to various ancient and fantastical planets (created by yours truly) to combat the rising power of the evil Red Talon corporation. While working alone in this server is plausible, it is also foolish. We here at Epsilon are huge advocates for teamwork as it not only improves overall RP experience, but it also leads to more interesting and diverse scenarios for you and your new friends to enjoy. You heard me right, friends! Epsilon gladly welcomes anyone of any race, culture, background or identity, regardless of whether or not you are a member of the LGBTQ+ or if you are just an 8ft tall Sangheili, we are all friends here!

This is based on Red VS Blue’s project freelancer and is a custom rp server that involves:
- Team based mission RP 🕴️
- A competitive leaderboard to flex on all your pals 💪
- Frequent and inclusive events (nitro) 🫨
- Friendly staff who will be your new best friends 😎
- Acceptance of everyone, unless you are from Formby, which case I want my money back 🏳️‍🌈
- POKECORD 🦆
- Comedy 🤓
- Women (I think)🤷
- HUNGER GAMES! 🕺
- CQ Cumber 🐐
So if you like what I described and you think this server fits your vibe. Join! I would love to see you there and so would everyone else. If you still have any questions then all you got to do is ask me or our dedicated staff team (I love them) who will gladly offer assistance to solve any quibbles and quabbles you may have. I truly hope to see you there.

-Colorado

Today's activity
15💬
30🟢
6👥
0📞
Server overview
132👥Total members
6📅years old
13+Age requirement
server profile pic
Equestria Girls: Crossing Worlds
equestria girlsmlpmultifandomroleplay
Description

The Statue has more than just Equestria linked to it, what heroes or villains lurk beyond that shining marble?? Only you can find out.
Welcome to Equestria Girls: Crossing Worlds! Here you’ll experience the story of Equestria Girls again with all new characters, plots, and maybe even shorts between arcs focused on your character!

Here’s what we have to offer:

> Most fandoms are able to be played

> All Equestria Girls or My Little Pony characters can be played

> OCs are welcome!

> A non-toxic environment

> New stories are able to be made alongside the story of Equestria Girls!

> Everyone can interact with the main story!

> Mod applications open!

Today's activity
27💬
27🟢
5👥
0📞
Server overview
129👥Total members
1📅years old
16+Age requirement
server profile pic
Furry Valley
furrysocialchillgamesvoicefunsfwroleplaymovieanimefurries
Description

The Future of the Furry Fandom! Come on in! :3

Today's activity
796💬
1.4k🟢
44👥
2📞
Server overview
12.4k👥Total members
9📅years old
13+Age requirement
Description

Doctor Who roleplay servers looking for new, active members. If you ever wanted to roleplay Doctor Who this server is the place to go! All Doctor Who lore is welcome on the server. We allow most characters outside of Doctor Who as long as they are science fiction in nature. This is a free-form server so your plot matters! We are open, friendly, and drama free. We look forward to seeing you on the server soon!

Today's activity
5.3k💬
140🟢
45👥
12📞
Server overview
710👥Total members
6📅years old
14+Age requirement
server profile pic
Girls Frontline: Mercenaries
gflgirls frontlinegirlsfrontlineroleplay
user profile pic
theonlychen12-09-2023 15:06

Have fun, and go chill. Maybe pick up a few things and start exploring.

Description

Year 2066, a full year has passed since G&K achieved a victory against Paradeus, following their resignation and dissolution. The remnants of various factions found themselves in East Asia, the most viable option to relocate their forces to. Struggling to float on the surface, they resorted to undertaking contract jobs and offering services to nearby countries and contractors. Welcome to Girls' Rearline: Mercenaries, a Discord roleplay community rooted in the world settings and lore of the renowned mobile gacha game, Girls' Frontline. Immerse yourself in an interactive experience where staff and roleplayers come together to craft engaging roleplays, events, and partake in thrilling and engaging adventures within the game's universe. 1) Exciting large and small events and narrations by dedicated and creative staff members and gamemasters. 2) Endless possibilities, create a faction, start a company, be a hero or a villain and take part in the server's storyline.* 3) Partake in OOC discussions when you're not feeling the vibe to roleplay, featuring various miscellaneous channels. 4) Active roleplayers and staff, make friends and embark in roleplays together, or fight each other in a large conflict. 5) Accepting various styles of roleplay. Social, combat, literature, casual. Pick your most comfortable ones. 6) Cute and funny gifs, emotes and stickers for you to spam around the chats for cute and funny purposes. 7) Loose and core community rules that protects our members' freedom of speech, as well as from senseless toxicity. Created by the moderation members of several popular Girls' Frontline roleplay servers such as Voron, Tacitus, Exilium, and The Alter in a revolutionary reforge, you'll surely find something fitting your taste in our server. Join the server and start your adventure! *Player must apply for GM role to create faction

Today's activity
391💬
59🟢
13👥
1📞
Server overview
201👥Total members
3📅years old
13+Age requirement
server profile pic
the Eternity
horrorroleplaywriting
Description

a new, somewhat horror based rp server set in a luxury hotel. Ocs and canon characters are allowed. We're just starting off, so join now!

Today's activity
155💬
5🟢
6👥
0📞
Server overview
17👥Total members
2📅years old
16+Age requirement
server profile pic
RP n’ Chill
role-playroleplay
user profile pic
crabhighpriest05-08-2023 07:00

The people on this server are awesome, I am lucky to have them, and they will tear you to pieces when you join

user profile pic
LEAN07-09-2023 04:32

MEN KISSING RAHHH

user profile pic
mvrk_jrdn05-01-2024 21:36

I LOVE THIS SERVER GRAH

Description

We are a 15+ SFW roleplay and community server, dedicated to connecting you with other roleplayers and people who have similar interests.

Here are some of the things we offer:

»» A fun and varied community! 🤗
We have a lot of users, with a lot of interest. Everything from writers, artists, to gamers! (Basically every mainstream niche, and a bit more) Our community is a little chaotic at times, while also accepting and respectful.

»» Endless possibilities! 🌟
Without an overarching plot, users create their own roleplays in their worlds of choice. Have an idea you’ve always wanted to try? A character that doesn’t fit you want to use? You can do it!

»» No OC submissions! 💯
We believe that roleplayers can mostly moderate themselves and their roleplays, whether your character works in your roleplay is up to whoever is organizing!

»» All literacy levels allowed! ✏️
Pretty simply, we don’t have any maximum or minimum for how much or how well you write. As long as your rp partner is happy, we are happy.

»» Safe environment! 🛡️
We maintain an environment that is SFW and protected, and can be sure we will moderate against any creeps. Sensitive topics are locked behind opt-in channels or spoilers. NSFW rps, or ERPs, are never allowed within or through the server.

Hope to see you soon!

Today's activity
7.1k💬
147🟢
26👥
0📞
Server overview
1.1k👥Total members
5📅years old
15+Age requirement
Description

***TOKYO GHOUL - TRIBUTES***

*This server is 16+!*
It is modern day Tokyo. Years have passed since the Dragon War. Faux allyships between Ghoul and Mankind have crumbled like castles under poor leadership and glorified silver linings. From the ashes rose tired, angry, and vengeful ghouls that were given fragile promises and hope at living a normal life.

The United Front and newly-instated CCG, lead by Matsuri Washuu, are now at war. The CCG believes that it is their rightful title as Japan's proper justice division and that all ghouls must be executed as a means to prevent a third-wave’s occurrence as well as another Dragon Incident. The wards have been distorted in chaos underneath the surface, as constant warring over Tokyo's wards appears to be never-ending.

The strange world just got stranger. The dead are mysteriously rising, old organizations are returning with new faces and new leadership, and the ghoul and human worlds as we know it are headed for significant changes.

Here there is a very lax ranking system, meaning that, until the free-spots are filled for higher ranking ghouls / investigators you may have to have your character be higher ranked. For those that miss out, do not fret. We are solely-activity based, meaning the longer / more active you are the higher the rank you can become via the Arcane bot level system **in roleplay channels only**. Both canons and original characters are welcome. Create your own paths - your lore is incorporated into the server's lore. Have fun and enjoy your stay!

*What we offer*

- Unlimited OCs
- A complete, unique server with all 24 wards and location channels within them
- Semi-lit - Adv. Lit RP
- A small but growing community of friendly, creative people
- Canon Character roles
- Gartic, music bots and streaming voice chats

Today's activity
38💬
9🟢
1👥
0📞
Server overview
44👥Total members
2📅years old
16+Age requirement
server profile pic
Bleach: Phantom Conflict the sequel
animeanime roleplayanime rpbleachbleach roleplaybleach rpcommunityroleplay
Description

**. . . . . ╰──╮Bleach: Fall of The Soul Society╭──╯ . . . . .**

In this world, everything in this realm relies on balance. Everything has a process and everything has a flow. In the same way which life has a process, so does death. When a life ends, there is far more to explore. As a matter of fact, one may have access to more in death than they once had in life

A soul can take a variety of paths. A soul may fall with order and a desire to keep peace. One may fall with justice and a wish to destroy the unjust. While others may be fueled with an unimaginable, all consuming darkness.

Welcome to *Bleach: Fall of The Soul Society*! Glad you've decided to take a look at our server. We're happy to introduce you to our

˚₊· ͟͟͞➳❥ Entertaining community

˚₊· ͟͟͞➳❥ Efficient admin team

˚₊· ͟͟͞➳❥ Frequent discussions and conversational topics

˚₊· ͟͟͞➳❥ Variety of different roleplayers with different goals

˚₊· ͟͟͞➳❥ No shortage of roleplay options or locations

˚₊· ͟͟͞➳❥ Simple but effective ranking system for better combat

We hope to see you here. Enjoy yourself!

Today's activity
30💬
14🟢
1👥
0📞
Server overview
50👥Total members
2📅years old
16+Age requirement
server profile pic
ONE PIECE ! :: MODERN AU
one pieceroleplaymodern auhangoutanimemangaanimanga
Description

╰┈➤Hello, and welcome to ONE PIECE ! :: MODERN AU ! ‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿ ,,We are a 17+ Modern OP roleplay server! ˗ˏˋ we have lots to offer, such as ... ‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿‿ ꕥ Welcoming of all types of people ! ( LGBT+ , POC , Systems ect. ) ꕥ LOTS of open character slots ! ꕥ A small staff team looking to expand ! ꕥ Easy to navigate channels & places to suggest channels ! ꕥ A place for roleplay spectators & regular chatters ! ꕥ Helpful staff when it comes to character submissions ! ╰┈➤ AND MORE !! If you would like to join, please remember that we are a 17+ & semi-lit roleplay server! Hope to see you soon!

Today's activity
23💬
18🟢
1👥
0📞
Server overview
31👥Total members
2📅years old
17+Age requirement
Description

*A girl moves house with her mother and discovers that it was her childhood home where her sister went missing. The forest next to the house draws her in and she wakes up there every night at 1am ever since she first explored. She meets a bunch of people from all different points in time who are also stuck in the forest. They have to fight off all kinds of monsters together and have a few laughs on the way before tragedy.*

Today's activity
10💬
23🟢
2👥
0📞
Server overview
119👥Total members
1📅years old
13+Age requirement
server profile pic
Ridgeford Isles RP
roleplayzombie-rppost-apocalypticpost-apocalypseapocalypse-rp
user profile pic
teralive.01-12-2023 14:04

boo

Description

welcome to ridgeford! a small american town located off the northwest coast of the US. you're a survivor, and find the island has been left in ruin after an apocalypse has swept the nation. it is up to you - as one of the lone survivors - to uncover the mysteries behind this island; and the source of the so called angels that ravage it.

Today's activity
9💬
7🟢
1👥
0📞
Server overview
7👥Total members
2📅years old
15+Age requirement
server profile pic
Animation Destination Role-play
roleplaydisneydreamworksilluminationnickelodeon
Description

Hi! I'm looking for mature people or people 18 years of age and older that love animation to join a Discord roleplay. Roleplay in any style you want. You can choose animated characters from Disney, DreamWorks, Illumination, Nickelodeon, and more. Hope to see you there!

Today's activity
6💬
9🟢
2👥
0📞
Server overview
45👥Total members
1📅years old
18+Age requirement
Description

Welcome to 𝐇𝐨𝐫𝐬𝐞𝐬𝐡𝐨𝐞 𝐎𝐯𝐞𝐫𝐥𝐨𝐨𝐤! This is a NEW third person literate canon ONLY Red Dead Redemption server! This is an 18+ ONLY server so minors are prohibited. Here we offer a canon story based lore as well as creating your own roleplays and interactions!

Here we have:

Self Roles! 🏜️

Many open canon characters! 🤠

Tupper bot! 🌵

Friendly members! ❤️

Announcements and events!!📣

Feel free to join and be part of this lil family! 🪶🏜️

Today's activity
4💬
9🟢
2👥
0📞
Server overview
14👥Total members
1📅years old
18+Age requirement
Description

+ ━━━━☆ WELCOME TO THE GREENFIELD ACADEMY! ☆━━━━ +

Embark on a thrilling journey into the extraordinary at Greenfield Academy, where the year is 2044, and a new generation of heroes is rising. Dive into a captivating server where you have the power to shape your own original characters and unfold epic tales of heroism and discovery!

✨ Unleash Your Superhuman Potential ✨

Step into the bustling metropolis of Charter City, home to Greenfield Academy, a prestigious institution for molding future heroes. The students possess unique powers inherited from their grandparents who experienced an event known as "The Black Hole Incident." Explore a world where extraordinary abilities are the norm, and the line between hero and villain blurs.

🦸 Craft Your Heroic Legacy 🦸

Create your very own OC, from their compelling backstory to the depths of their superhuman abilities. Immerse yourself in a universe that celebrates originality, where your character's journey is untethered from existing storylines. Join forces with other members to weave tales of heroism, friendship, and self-discovery.

🚀 Soar Above the Rest 🚀

Here at Greenfield Academy, originality reigns supreme. Engage in a rich lore, explore diverse channels to enhance your OC's story, and immerse yourself in a non-toxic community that values creativity and collaboration. We understand the importance of real life, so join roleplays at your own pace without pressure.

What We Offer

- A unique roleplaying experience within the Greenfield Academy universe.
- Diverse channels for character development (Designs, Theme songs, Headcanons, Etc.).
- A welcoming and non-toxic community.
- Flexibility in roleplay participation, attend when you can.

Join us at Greenfield Academy, where destinies are forged, and the legacy of the next generation of heroes begins. Uncover your superhuman potential and let the adventure unfold!

Join the Journey Today!

Today's activity
4💬
25🟢
2👥
0📞
Server overview
94👥Total members
3📅years old
13+Age requirement
Description

Little Heartaches, a little nightmares AU

After Six dropped Mono into the signal tower he became a slave to it, the thin man ensures that he can't leave the city. His only hope for escaping is a little girl called Noone, who saw something in the tower, something she wasn't supposed to see.

Six is far away from Pale City, aboard the Maw. She has no memory of Mono as all the pain and suffering Monos "betrayal" caused had made part of herself separate and become Shadow Six, who keeps Six from the truth and tries to distract her. Like bringing her to the Maw so she can find her long lost brother Seven, the runaway kid.

Otto continues his search for his long lost brother and sister (Mono and raincoat girl). He claims he's a specialist in dream psychology, and that he can cure nightmare disorder. Which gives him a steady supply of children

What we offer!
100s of RP channels with pictures pinned

Plot driven RP, this server will have on overarching story which everyone can be a part of, whether they're using ocs or cannons

The Sounds of Nightmares characters are claimable and we are(as far as I know) the first ln server to include them in the lore!

You can RP in and out of the Nowhere, patients and psychiatrists are allowed. Gatekeeper ocs are too!(a gatekeeper is basically like the candleman, taking kids across the threshold bla bla bla)

A welcoming and kind community (even if it's small)

We hope that you join, see you there!

Today's activity
3💬
18🟢
3👥
0📞
Server overview
51👥Total members
2📅years old
13+Age requirement
server profile pic
Taisho High: The First Aces!
fantasyhighschoolmagicocroleplaysci-fi
Description

WELCOME TO THE GRAND REOPENING OF TAISHO HIGH!

Whether you're a visitor looking in, or returning member, we welcome you with open arms! We're an exciting high school based RP server, which takes place further inti the future!

✨Rise through the ranks and discover your true power! ✨

At taisho high, you can expect:

* An easy to understand class system

* Wide range of freedom for OC'S

* Several opportunities for deep character development

* Engaging events, with valuable server rewards

* Helpful staff

* Progression of power

And much more!

Will you become a true Ace?

Today's activity
3💬
27🟢
3👥
0📞
Server overview
63👥Total members
2📅years old
13+Age requirement
server profile pic
Booty Owl ✩₊˚.⋆☾𓅔☽⋆⁺₊✧
rpfantasyvchangoutcreativefriendlyfriendsfunchatart18+roleplaygamingchillactivesocialcommunity
user profile pic
vin873425-09-2025 13:40

welcome to the dumpster fire!

user profile pic
vin873422-10-2025 23:45

Happy Halloween 🖤🍁

Description

Welcome to the Booty Owl community! It's a galaxy far, far beyond Discord servers. May the owls be with you, always!

Today's activity
2💬
18🟢
1👥
0📞
Server overview
39👥Total members
1📅years old
18+Age requirement
server profile pic
Call of the Order:Deadux
roleplayfantasymagicaction
Description

```CALL OF THE ORDER
```

╭━ ⋅𖥔⋅ ━━✶━━ ⋅𖥔⋅ ━╮

Long ago the land of Auream was in an age of peace, until the greed of a lord plunged the world into a state of chaos and frenzy. It was not until the will of one man and his apostles sought to bring forth order to the once golden lands that peace was partially restored. But in the Lords wake, chaos still roamed.

Your arcane skills are in high demand. Join one of the five houses of The Order and begin vanquishing scourges and undying souls. The Order has called out to you, and they look forward to working with you.

**The Order has found favor with you. Join now and see what is in store for you.**

┏ ━━┅━━━┅━━ ┓

- *Intricate Stat System*
- *5 Houses to Choose From*
- *Custom Races*
- *Helpful Staff*
- *Intricate Lore*
- *Progression of Power*

┗ ━━┅━━━┅━━ ┛

Today's activity
2💬
14🟢
2👥
0📞
Server overview
28👥Total members
2📅years old
13+Age requirement
Description

[QUICK DISCLAIMER: This is a ROLEPLAY server. If you are here to trade, do not join.] 2 worlds exist, the human world, and the Yo Kai World. They used to be separate, but some time, long ago in the past, their borders got hazy and Yo-Kai started to pour in, and cause all sorts of troubles for humans! Completely invisible to the human eye, they inspirit people and cause problems ranging from the mild annoyance to major danger. Luckily, a device exists to allow humans to see and even befriend the Yo-Kai! Can a peace be reached between the 2 worlds, or is an unseen catastrophe right on the horizon?

Today's activity
2💬
36🟢
2👥
0📞
Server overview
228👥Total members
5📅years old
13+Age requirement
server profile pic
DEAD SERVER
40kcasualchatfunloreloungeroleplayrpgwarhammerwarhammer40kwarhammer-rpwarhammerrp
Description

It is the final years of the 30th Millennium.

The Emperor, still in his corporeal form, leads the armies of mankind at the frontlines himself. The Imperium of Mankind has conquered much of the galaxy, yet many still remain in enemy hands.

The Imperial Powerhouse, scattered throughout the galaxy, continues to wage war against their enemies with staggering success. Spearheaded by the Legions of the Adeptus Astartes, the Imperium of Man enjoys several victories, and thousands of reconquered worlds.

But, a force unknown to most whispers in the Emperor's ear, threatening to upend his entire effort at uniting the galaxy under human dominance. He ignores them. No, he prepares for the inevitable day when the ruinous powers take him head on. He knows he is resistant to their vain promises, but can he say the same for his children?

He protects... but for how long?

Warhammer 30,000: Golden Throne Woes is a 30k Roleplay server set in a universe wherein most of the canonical characters are non-existent. Instead, their spots are ripe for the taking... by you! Primarchs and Legions are available for claiming, awaiting creation.

We offer you a welcoming and inclusive community, where our priority is fun and your well-being. Rest assured that we are not here to talk about real world politics, or argue about controversial real life drama: we are here to escape the realities of life, to have fun!

While we took some alterations to the lore, the timeline remains mostly the same. That is when YOU come in. You have the power to influence the lore, to change the course of history, for better or worse.

You also have the power to join this server. Why not take it?

Today's activity
2💬
16🟢
2👥
0📞
Server overview
55👥Total members
2📅years old
13+Age requirement
Description

Violent winds hissed around the borders of Empyrea. Intimidating avians stood guard with shimmering swords and heavy armour.
Suddenly, a voice rung out.
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
𝐍𝐨𝐧-𝐀𝐯𝐢𝐚𝐧 | "Stand on the wall for your picture." You walk over to the wall, the border patrol agent looking you up and down. A snap flashes before you. "Fill this out." You fill out your date of birth, full name, species, and give it back. After a moment, the following is handed to you and the barrier opens.
╔═══ .·:·.⚔︎✧ ✦ ✧𓂋.·:·. ═══╗
ᴇᴍᴘʏʀᴇᴀ ɪᴅ ᴄᴀʀᴅ
Identification NO: 13XXXX
DOB: M/D/Y
Issue Date: M/D/Y
Full Name: Jane Doe
Species: Species
Class: A0 - A4
Sect: -
ꜰᴏᴜɴᴅ? ʀᴇᴘᴏʀᴛ ᴛᴏ ᴇᴍᴘʏʀᴇᴀɴ ʙᴘ ᴏꜰꜰɪᴄᴇ.
╚═══ .·:·.⚔︎✧ ✦ ✧𓂋.·:·. ═══╝
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
𝐀𝐯𝐢𝐚𝐧 | "Identification card please." You hand over your ID card. The Border Patrol Agent glances at it, you, and nods. "Welcome back." The barrier opens.
╔═══ *.·:·.⚔︎✧ ✦ ✧𓂋.·:·.* ═══╗
ᴇᴍᴘʏʀᴇᴀ ɪᴅ ᴄᴀʀᴅ
Identification NO: 01XXXX | 02XXXX
DOB: M/D/Y
Issue Date: M/D/Y
Full Name: Jane Doe
Species: Avian
Class: A0 - A4 | DO -D4
Sect: Warrior | Noble
ꜰᴏᴜɴᴅ? ʀᴇᴘᴏʀᴛ ᴛᴏ ᴇᴍᴘʏʀᴇᴀɴ ʙᴘ ᴏꜰꜰɪᴄᴇ.
╚═══ *.·:·.⚔︎✧ ✦ ✧𓂋.·:·.* ═══╝
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
ʟɪᴋᴇ ᴡʜᴀᴛ ʏᴏᴜ ʀᴇᴀᴅ? ᴍᴏʀᴇ ɪɴꜰᴏʀᴍᴀᴛɪᴏɴ ᴀᴠᴀɪʟᴀʙʟᴇ ᴀᴛ: https://discord.gg/hw8thdvh9D
⚔︎ .  ⁺   . ✦ .  ⁺   . 𓂋.  ⁺   . ⚔︎ .  ⁺   . ✦.
ꜱᴜᴍᴍᴀʀʏ: ʟᴀɴᴅ ᴏꜰ ᴇᴍᴘʏʀᴇᴀ ɪꜱ ᴀ ꜰʀᴇᴇꜰᴏʀᴍ ꜰᴀɴᴛᴀꜱʏ ꜱᴇʀᴠᴇʀ ʜᴏᴍᴇ ᴛᴏ ᴛʜᴇ ᴇᴍᴘʏʀᴇᴀɴꜱ. ᴡᴀʀʀɪᴏʀꜱ ᴀʀᴇ ᴇᴍᴘʏʀᴇᴀ'ꜱ ᴀʀᴍᴏᴜʀ, ᴅᴇꜰᴇɴᴅɪɴɢ ᴛʜᴇɪʀ ᴍᴏᴛʜᴇʀʟᴀɴᴅ ᴡɪᴛʜ ʙʀᴀᴠᴇʀʏ ᴀɴᴅ ʜᴏɴᴏʀ. ɴᴏʙʟᴇꜱ ᴀʀᴇ ᴇᴍᴘʏʀᴇᴀ'ꜱ ʙʟᴏᴏᴅ, ꜱᴜꜱᴛᴀɪɴɪɴɢ ᴛʜᴇɪʀ ᴄᴜʟᴛᴜʀᴇꜱ ꜱᴜʀᴠɪᴠᴀʟ. ᴅᴇᴠᴇʟᴏᴘ ᴡʜᴏ ʏᴏᴜ ʙᴇᴄᴏᴍᴇ ᴛʜʀᴏᴜɢʜ ʀᴏʟᴇᴘʟᴀʏ, ᴍɪꜱꜱɪᴏɴꜱ, ᴀɴᴅ ᴇᴠᴇɴᴛꜱ. ᴇxᴘʟᴏʀᴇ ʏᴏᴜʀ ᴘᴏᴛᴇɴᴛɪᴀʟ ᴛᴏᴅᴀʏ: ᴀᴠɪᴀɴ ᴏʀ ɴᴏɴ-ᴀᴠɪᴀɴ!

Today's activity
1💬
10🟢
1👥
0📞
Server overview
33👥Total members
3📅months old
17+Age requirement
server profile pic
Pine Creek Summer Camp 🏕
roleplayrpslice of lifesolcommunity
Description

We are an 18+ SFW roleplay server that mainly focuses on slice of life but we encourage our members to be as creative as they wish. Whether you want some adventure, angst, mystery or romance, we can do it all here.

We encourage creativity and enjoy a smattering of chaos from time to time - whether it be kids getting revenge against a mean staff member, escalating prank wars or accidentally burning down the boathouse with a misplaced firework.

The Pine Creek Summer Camp is an inclusive camp for children and teenagers from all walks of life - with special catering for those who are disabled, neurodivergent or in any way impoverished or troubled. With fun indoor and outdoor activities, all are welcome.

We have dozens of indoor and outdoor locations for 1x1 and small group roleplays as well as chatroom style channels you can use to talk as your characters to other characters. We use Tupperbox for added immersion and are happy to help beginners set up their characters and learn how to use it.

What we offer:
▫️ A welcoming, friendly community
▫️ Inclusive to everybody, regardless of race, religion, gender or sexuality
▫️ Dedicated staff who are passionate about roleplaying
▫️ OOC chat channels
▫️ Media, meme, and art channels

Today's activity
1💬
18🟢
1👥
0📞
Server overview
36👥Total members
8📅months old
18+Age requirement
server profile pic
The Oaken City
roleplayfantasymoderncommunityrp
Description

<-| The Oaken City is a fresh community and roleplaying server aiming to provide a wonderful general hang-out place for all those interested! <-|-> Our theme is, in the broadest sense, that of a modern town slice-of-life roleplay. More specifically on a North-European island republic and more interestingly one made into the crossroads of the three existential planes. For the first time in a millennium, humans and fantasy creatures may co-exist again, in the city that has become a symbol of modern prosperity, Eiksby. <-|-> Besides this little bit of lore, our server seeks to accommodate whatever creative interests its members may have as well as provide an enjoyable friendly community for all to enjoy! We wish for friendly chatting, discussion and sharing of ideas to bring all our members together and help us all grow happier and better. <-|-> I hope to have persuaded you, dear reader, and you are always welcome to come join us in The Oaken City! |->

Today's activity
1💬
12🟢
1👥
0📞
Server overview
19👥Total members
1📅years old
16+Age requirement
server profile pic
The MegaCountry SMP - LAUNCH ????
gamesminecraftminecraft smpminecraft-java-editionrp minecraft gamingroleplaymoddedmodsgamingcommunityfunsfwpoliticsnontoxic
user profile pic
youthd4814-12-2024 08:26

This server is awesome!

Description

📜 🌎 Welcome to the MegaCountry SMP, a new modded Minecraft SMP with 30+ players that will start operations soon! We are a modded Minecraft PolSim SMP with many ways to run things! Work your way up the ranks from resident to president, and forge alliances with other players across the multiple city-states! As more players join the SMP, the city-states available to join and lead will increase! Will you lead your city-state to prosperity? Or will your city-state fall to ruin? Our server is nontoxic and strictly adheres to Discord's Community Guidelines. Join us! Your story is what you make of it, and it'll be awesome!

Today's activity
1💬
24🟢
1👥
0📞
Server overview
81👥Total members
1📅years old
13+Age requirement
server profile pic
The Darkness rises
roleplaywingsoffirewofdragonscommunity
Description

This is a wings of fire Roleplay server! This takes place after the books and pantala was hidden for a while before being re born! And re introduced. But there’s a catch, weird hybrid royalty started to hatch from the hivewing Queen? As in tribes of 5 of 8 of 10? Even 11?

The Allwing that lies there has a fate bigger then he relized, but it’s split in half? His father wants him for the wars on the other continent. His mother wants the peace and fate dragoness start to appear along with a song with deeper meaning.. will that darkness rise or will peace fall among everyone? Only you have the power to decide!

We have a large arrangement of channels to pick from, lore that constantly updates and grows and staff that have open hearts to help with any questions or concerns!

We try to stay active with sorted day to night changes, weather changes and sometimes channel changes! If you have a character that cannonly has a shop? Just let me know and I don’t mind adding it! Have a Prince that has a special room? We can add it! Do you have a stronger character or a unique looking one? Just let us know and we will make a way for you to add it!

We also have art and writing events! If it’s having a party at party hive or showing of your dragons green thumb there are many options for art and writers!

Come on down and have some fun! We welcome all with open talons!

Other things we have:
-open prince and princess spots
-Adopts
-Raffles
-Ranting areas for characters

We hope to see you there!

Today's activity
1💬
15🟢
1👥
0📞
Server overview
52👥Total members
2📅years old
15+Age requirement

210 servers found